Lineage for d1mjpb_ (1mjp B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3582Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 3583Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 3623Family a.43.1.2: Bacterial repressors [47604] (2 proteins)
  6. 3624Protein Met repressor, MetR [47607] (1 species)
  7. 3625Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. 3655Domain d1mjpb_: 1mjp B: [17489]

Details for d1mjpb_

PDB Entry: 1mjp (more details), 3.4 Å

PDB Description: methionine aporepressor mutant (q44k) complexed to the minimal met consensus operator

SCOP Domain Sequences for d1mjpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjpb_ a.43.1.2 (B:) Met repressor, MetR {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOP Domain Coordinates for d1mjpb_:

Click to download the PDB-style file with coordinates for d1mjpb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mjpa_