Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) |
Family d.278.1.1: H-NOX domain [111127] (2 proteins) binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains automatically mapped to Pfam PF07700 |
Protein Methyl-accepting chemotaxis protein [111128] (1 species) |
Species Thermoanaerobacter tengcongensis [TaxId:119072] [111129] (18 PDB entries) Uniprot Q8RBX6 1-191 |
Domain d3eeea_: 3eee A: [174887] automated match to d1u4ha_ complexed with cl, hem, oxy, so4 |
PDB Entry: 3eee (more details), 2.12 Å
SCOPe Domain Sequences for d3eeea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eeea_ d.278.1.1 (A:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis [TaxId: 119072]} mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatparliak pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn pvfeykkn
Timeline for d3eeea_: