SCOPe 2.06: Domain d3ee5b_: 3ee5 B:

Lineage for d3ee5b_ (3ee5 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)

6. Protein automated matches [190297] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187395] (17 PDB entries)

8. Domain d3ee5b_: 3ee5 B: [174877]
   automated match to d1tvya_
   complexed with 2na, dio, gol, mes, mn, so4, udh

Details for d3ee5b_

PDB Entry: 3ee5, 2.2 Å

PDB Description: crystal structure of human m340h-beta1,4-galactosyltransferase-i (m340h-b4gal-t1) in complex with glcnac-beta1,3-gal-beta- naphthalenemethanol

PDB Compounds: (B:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d3ee5b_:

Sequence; same for both SEQRES and ATOM records:

>d3ee5b_ c.68.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
nywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdriahtket
mlsdglnsltyqvldvqryplytqitvdigtps

Timeline for d3ee5b_:

• d3ee5b_ first appeared in SCOPe 2.01
  
• d3ee5b_ appears in SCOPe 2.05
  
• d3ee5b_ appears in SCOPe 2.07
  
• d3ee5b_ appears in the current release, SCOPe 2.08