Lineage for d3ee3f_ (3ee3 F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907823Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1907824Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1908074Protein automated matches [190032] (15 species)
    not a true protein
  7. 1908075Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 1908137Domain d3ee3f_: 3ee3 F: [174875]
    automated match to d2b8pa1
    complexed with cdp, mg

Details for d3ee3f_

PDB Entry: 3ee3 (more details), 2.4 Å

PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with CDP
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3ee3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ee3f_ d.58.6.1 (F:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfp

SCOPe Domain Coordinates for d3ee3f_:

Click to download the PDB-style file with coordinates for d3ee3f_.
(The format of our PDB-style files is described here.)

Timeline for d3ee3f_: