Lineage for d3ee3e1 (3ee3 E:2-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951328Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 2951369Domain d3ee3e1: 3ee3 E:2-131 [174874]
    Other proteins in same PDB: d3ee3a2, d3ee3b2, d3ee3c2, d3ee3d2, d3ee3e2, d3ee3f2
    automated match to d2b8pa1
    complexed with cdp, mg

Details for d3ee3e1

PDB Entry: 3ee3 (more details), 2.4 Å

PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with CDP
PDB Compounds: (E:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3ee3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ee3e1 d.58.6.1 (E:2-131) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfpet

SCOPe Domain Coordinates for d3ee3e1:

Click to download the PDB-style file with coordinates for d3ee3e1.
(The format of our PDB-style files is described here.)

Timeline for d3ee3e1: