Lineage for d3edaa_ (3eda A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1076387Protein Myoglobin [46469] (9 species)
  7. 1076503Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (229 PDB entries)
    Uniprot P02185
  8. 1076531Domain d3edaa_: 3eda A: [174863]
    automated match to d104ma_
    complexed with cmo, hem, so4

Details for d3edaa_

PDB Entry: 3eda (more details), 1.21 Å

PDB Description: carbonmonoxy sperm whale myoglobin at 100 k: laser on [150 min]
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3edaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3edaa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d3edaa_:

Click to download the PDB-style file with coordinates for d3edaa_.
(The format of our PDB-style files is described here.)

Timeline for d3edaa_: