Lineage for d3ed8a_ (3ed8 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (19 species)
    not a true protein
  7. 2165183Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (52 PDB entries)
  8. 2165236Domain d3ed8a_: 3ed8 A: [174857]
    automated match to d1qyoa_

Details for d3ed8a_

PDB Entry: 3ed8 (more details), 2.7 Å

PDB Description: Application of the superfolder YFP bimolecular fluorescence complementation for studying protein-protein interactions in vitro
PDB Compounds: (A:) yellow fluorescence protein

SCOPe Domain Sequences for d3ed8a_:

Sequence, based on SEQRES records: (download)

>d3ed8a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptlv
ttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlvn
rielkgtdfkedgnilghkleynfnshnvyitatrgtaaarpackipndlkqkvmnhdkq
kngikanftvrhnvedgsvqladhyqqntpigdgpvllpdnhylsyqtvlskdpnekrdh
mvllefvtaagit

Sequence, based on observed residues (ATOM records): (download)

>d3ed8a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptlv
ttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlvn
rielkgtdfkedgnilghkleynfnshnvyitatrgtqkngikanftvrhnvedgsvqla
dhyqqntpigdgpvllpdnhylsyqtvlskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d3ed8a_:

Click to download the PDB-style file with coordinates for d3ed8a_.
(The format of our PDB-style files is described here.)

Timeline for d3ed8a_: