Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (229 PDB entries) Uniprot P02185 |
Domain d3ecza_: 3ecz A: [174849] automated match to d104ma_ complexed with cmo, hem, so4 |
PDB Entry: 3ecz (more details), 1.21 Å
SCOPe Domain Sequences for d3ecza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ecza_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp gdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d3ecza_: