SCOPe 2.08: Domain d3ecwd_: 3ecw D:

Lineage for d3ecwd_ (3ecw D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries)

8. Domain d3ecwd_: 3ecw D: [174847]
   automated match to d1hl4a_
   mutant

Details for d3ecwd_

PDB Entry: 3ecw, 2.15 Å

PDB Description: crystal structure of the als-related pathological mutant t54r of human apo cu,zn superoxide dismutase (sod1)

PDB Compounds: (D:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3ecwd_:

Sequence, based on SEQRES records:

>d3ecwd_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnragctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records):

>d3ecwd_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnragctsa
gphfnphvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekadsrlacgvig
iaq

Timeline for d3ecwd_:

• d3ecwd_ first appeared in SCOPe 2.01
  
• d3ecwd_ appears in SCOPe 2.07