Lineage for d3ecvc_ (3ecv C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 936845Species Human (Homo sapiens) [TaxId:9606] [49333] (55 PDB entries)
  8. 936989Domain d3ecvc_: 3ecv C: [174842]
    automated match to d1uxla_
    mutant

Details for d3ecvc_

PDB Entry: 3ecv (more details), 1.9 Å

PDB Description: Crystal structure of the ALS-related pathological mutant I113T of human apo Cu,Zn Superoxide Dismutase (SOD1)
PDB Compounds: (C:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3ecvc_:

Sequence, based on SEQRES records: (download)

>d3ecvc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records): (download)

>d3ecvc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplrhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvhekadgsrlacg
vigiaq

SCOPe Domain Coordinates for d3ecvc_:

Click to download the PDB-style file with coordinates for d3ecvc_.
(The format of our PDB-style files is described here.)

Timeline for d3ecvc_: