Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [188763] (1 PDB entry) |
Domain d3ecob_: 3eco B: [174834] automated match to d3broa1 complexed with so4 |
PDB Entry: 3eco (more details), 2.4 Å
SCOPe Domain Sequences for d3ecob_:
Sequence, based on SEQRES records: (download)
>d3ecob_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} tysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgpt vsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlseee neqmkanltkmlsslq
>d3ecob_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} tysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgpt vsnllrnlerkkliyryvkniglttsgiklveaftsifdemeqtlvsqlseeeneqmkan ltkmlsslq
Timeline for d3ecob_: