Lineage for d3ecob_ (3eco B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695091Species Staphylococcus aureus [TaxId:158878] [188763] (1 PDB entry)
  8. 2695093Domain d3ecob_: 3eco B: [174834]
    automated match to d3broa1
    complexed with so4

Details for d3ecob_

PDB Entry: 3eco (more details), 2.4 Å

PDB Description: Crystal structure of MepR, a transcription regulator of the Staphylococcus aureus multidrug efflux pump MepA
PDB Compounds: (B:) MepR

SCOPe Domain Sequences for d3ecob_:

Sequence, based on SEQRES records: (download)

>d3ecob_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
tysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgpt
vsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlseee
neqmkanltkmlsslq

Sequence, based on observed residues (ATOM records): (download)

>d3ecob_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
tysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgpt
vsnllrnlerkkliyryvkniglttsgiklveaftsifdemeqtlvsqlseeeneqmkan
ltkmlsslq

SCOPe Domain Coordinates for d3ecob_:

Click to download the PDB-style file with coordinates for d3ecob_.
(The format of our PDB-style files is described here.)

Timeline for d3ecob_: