SCOPe 2.04: Domain d3ecoa_: 3eco A:

Lineage for d3ecoa_ (3eco A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [188763] (1 PDB entry)

8. Domain d3ecoa_: 3eco A: [174833]
   automated match to d3broa1
   complexed with so4

Details for d3ecoa_

PDB Entry: 3eco, 2.4 Å

PDB Description: Crystal structure of MepR, a transcription regulator of the Staphylococcus aureus multidrug efflux pump MepA

PDB Compounds: (A:) MepR

SCOPe Domain Sequences for d3ecoa_:

Sequence, based on SEQRES records:

>d3ecoa_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee
eneqmkanltkmlsslq

Sequence, based on observed residues (ATOM records):

>d3ecoa_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
tvsnllrnlerkkliyryvdaqrrkniglttsgiklveaftsifdemeqtlvsqlseeen
eqmkanltkmlsslq

Timeline for d3ecoa_:

• d3ecoa_ first appeared in SCOPe 2.01
  
• d3ecoa_ appears in SCOPe 2.03
  
• d3ecoa_ appears in SCOPe 2.05
  
• d3ecoa_ appears in the current release, SCOPe 2.08