Lineage for d3ecoa_ (3eco A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (73 species)
    not a true protein
  7. 2307587Species Staphylococcus aureus [TaxId:158878] [188763] (1 PDB entry)
  8. 2307588Domain d3ecoa_: 3eco A: [174833]
    automated match to d3broa1
    complexed with so4

Details for d3ecoa_

PDB Entry: 3eco (more details), 2.4 Å

PDB Description: Crystal structure of MepR, a transcription regulator of the Staphylococcus aureus multidrug efflux pump MepA
PDB Compounds: (A:) MepR

SCOPe Domain Sequences for d3ecoa_:

Sequence, based on SEQRES records: (download)

>d3ecoa_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee
eneqmkanltkmlsslq

Sequence, based on observed residues (ATOM records): (download)

>d3ecoa_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
tvsnllrnlerkkliyryvdaqrrkniglttsgiklveaftsifdemeqtlvsqlseeen
eqmkanltkmlsslq

SCOPe Domain Coordinates for d3ecoa_:

Click to download the PDB-style file with coordinates for d3ecoa_.
(The format of our PDB-style files is described here.)

Timeline for d3ecoa_: