Lineage for d3ecna_ (3ecn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (9 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2015332Domain d3ecna_: 3ecn A: [174831]
    automated match to d1q9mc_
    complexed with ibm, mg, zn

Details for d3ecna_

PDB Entry: 3ecn (more details), 2.1 Å

PDB Description: Crystal structure of PDE8A catalytic domain in complex with IBMX
PDB Compounds: (A:) High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

SCOPe Domain Sequences for d3ecna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ecna_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddvppriarameneeywdfdifeleaathnrpliylglkmfarfgiceflhcsestlrsw
lqiieanyhssnpyhnsthsadvlhatayflskeriketldpidevaaliaatihdvdhp
grtnsflcnagselailyndtavleshhaalafqlttgddkcnifknmerndyrtlrqgi
idmvlatemtkhfehvnkfvnsinkplatleengetdknqevintmlrtpenrtlikrml
ikcadvsnpcrplqyciewaariseeyfsqtdeekqqglpvvmpvfdrntcsipksqisf
idyfitdmfdawdafvdlpdlmqhldnnfkywkgldem

SCOPe Domain Coordinates for d3ecna_:

Click to download the PDB-style file with coordinates for d3ecna_.
(The format of our PDB-style files is described here.)

Timeline for d3ecna_: