Lineage for d3ecia_ (3eci A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932757Protein automated matches [190358] (6 species)
    not a true protein
  7. 2932770Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries)
  8. 2932822Domain d3ecia_: 3eci A: [174827]
    automated match to d1v49a_

Details for d3ecia_

PDB Entry: 3eci (more details), 2.65 Å

PDB Description: Microtubule-associated protein 1 light chain 3 alpha isoform A (MAP1ALC3)
PDB Compounds: (A:) Microtubule-associated protein 1 light chain 3 alpha

SCOPe Domain Sequences for d3ecia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ecia_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfkqrrsfadrckevqqirdqhpskipviierykgekqlpvldktkflvpdhvnmselv
kiirrrlqlnptqaffllvnqhsmvsvstpiadiyeqekdedgflymvyasq

SCOPe Domain Coordinates for d3ecia_:

Click to download the PDB-style file with coordinates for d3ecia_.
(The format of our PDB-style files is described here.)

Timeline for d3ecia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ecib_