Lineage for d3ebmd1 (3ebm D:1-172)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428233Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2428234Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2428244Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
    automatically mapped to Pfam PF00838
  6. 2428245Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)
  7. 2428249Species Human (Homo sapiens) [TaxId:9606] [117337] (6 PDB entries)
    Uniprot P13693
  8. 2428258Domain d3ebmd1: 3ebm D:1-172 [174820]
    Other proteins in same PDB: d3ebma2, d3ebmb2, d3ebmc2, d3ebmd2
    automated match to d2hr9a1
    mutant

Details for d3ebmd1

PDB Entry: 3ebm (more details), 2.6 Å

PDB Description: crystal structure of human translationally controlled tumour associated protein (htctp) mutant e12v
PDB Compounds: (D:) Translationally-controlled tumor protein

SCOPe Domain Sequences for d3ebmd1:

Sequence, based on SEQRES records: (download)

>d3ebmd1 b.88.1.2 (D:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdvmfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc

Sequence, based on observed residues (ATOM records): (download)

>d3ebmd1 b.88.1.2 (D:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdvmfsdiykireiadglclevegkmvstgvdivmnhhlqetsftkeaykk
yikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmvalld
yredgvtpymiffkdglemekc

SCOPe Domain Coordinates for d3ebmd1:

Click to download the PDB-style file with coordinates for d3ebmd1.
(The format of our PDB-style files is described here.)

Timeline for d3ebmd1: