Lineage for d1mjqg_ (1mjq G:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3582Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 3583Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 3623Family a.43.1.2: Bacterial repressors [47604] (2 proteins)
  6. 3624Protein Met repressor, MetR [47607] (1 species)
  7. 3625Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. 3648Domain d1mjqg_: 1mjq G: [17482]

Details for d1mjqg_

PDB Entry: 1mjq (more details), 2.4 Å

PDB Description: methionine repressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to an altered met consensus operator sequence

SCOP Domain Sequences for d1mjqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjqg_ a.43.1.2 (G:) Met repressor, MetR {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOP Domain Coordinates for d1mjqg_:

Click to download the PDB-style file with coordinates for d1mjqg_.
(The format of our PDB-style files is described here.)

Timeline for d1mjqg_: