Lineage for d3ebmc1 (3ebm C:1-172)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407553Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2407554Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2407564Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
    automatically mapped to Pfam PF00838
  6. 2407565Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)
  7. 2407569Species Human (Homo sapiens) [TaxId:9606] [117337] (4 PDB entries)
    Uniprot P13693
  8. 2407576Domain d3ebmc1: 3ebm C:1-172 [174819]
    Other proteins in same PDB: d3ebma2, d3ebmb2, d3ebmc2, d3ebmd2
    automated match to d2hr9a1
    mutant

Details for d3ebmc1

PDB Entry: 3ebm (more details), 2.6 Å

PDB Description: Crystal structure of human translationally controlled tumour associated protein (hTCTP) mutant E12V
PDB Compounds: (C:) Translationally-controlled tumor protein

SCOPe Domain Sequences for d3ebmc1:

Sequence, based on SEQRES records: (download)

>d3ebmc1 b.88.1.2 (C:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdvmfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc

Sequence, based on observed residues (ATOM records): (download)

>d3ebmc1 b.88.1.2 (C:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdvmfsdiykireiadglclevegkmvtgvdivmnhhlqetsftkeaykky
ikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmvalldy
redgvtpymiffkdglemekc

SCOPe Domain Coordinates for d3ebmc1:

Click to download the PDB-style file with coordinates for d3ebmc1.
(The format of our PDB-style files is described here.)

Timeline for d3ebmc1: