SCOPe 2.03: Domain d3ebma_: 3ebm A:

Lineage for d3ebma_ (3ebm A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.88: Mss4-like [51315] (1 superfamily)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (4 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
   contains an insertion of alpha helical hairpin; lacks zinc-binding site
   automatically mapped to Pfam PF00838

6. Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117337] (2 PDB entries)
   Uniprot P13693

8. Domain d3ebma_: 3ebm A: [174817]
   automated match to d2hr9a1
   mutant

Details for d3ebma_

PDB Entry: 3ebm, 2.6 Å

PDB Description: crystal structure of human translationally controlled tumour associated protein (htctp) mutant e12v

PDB Compounds: (A:) Translationally-controlled tumor protein

SCOPe Domain Sequences for d3ebma_:

Sequence, based on SEQRES records:

>d3ebma_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdvmfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekclehh

Sequence, based on observed residues (ATOM records):

>d3ebma_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdvmfsdiykireiadglclevegkmvsitgvdivmnhhlqetsftkeayk
kyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmvall
dyredgvtpymiffkdglemekclehh

Timeline for d3ebma_:

• d3ebma_ first appeared in SCOPe 2.01
  
• d3ebma_ appears in SCOPe 2.02
  
• d3ebma_ appears in SCOPe 2.04
  
• d3ebma_ appears in the current release, SCOPe 2.08, called d3ebma1