SCOPe 2.01: Domain d3ebaa_: 3eba A:

Lineage for d3ebaa_ (3eba A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (16 PDB entries)

8. Domain d3ebaa_: 3eba A: [174815]
   Other proteins in same PDB: d3ebab_
   automated match to d1op9a_
   complexed with so4; mutant

Details for d3ebaa_

PDB Entry: 3eba, 1.85 Å

PDB Description: CAbHul6 FGLW mutant (humanized) in complex with human lysozyme

PDB Compounds: (A:) CAbHul6

SCOPe Domain Sequences for d3ebaa_:

Sequence; same for both SEQRES and ATOM records:

>d3ebaa_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlscsasgytyisgwfrqapgkglewvaairssdgttyyads
vkgrftisqdnakntvylqmnslkpedtamyycaatevagwpldigiydywgqgtqvtvs
sh

Timeline for d3ebaa_:

• d3ebaa_ is new in SCOPe 2.01-stable
  
• d3ebaa_ appears in SCOPe 2.02
  
• d3ebaa_ appears in the current release, SCOPe 2.08, called d3ebaa1