Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (63 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1076] [188556] (2 PDB entries) |
Domain d3eb2b_: 3eb2 B: [174810] automated match to d1xkya1 complexed with pge |
PDB Entry: 3eb2 (more details), 2.04 Å
SCOPe Domain Sequences for d3eb2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eb2b_ c.1.10.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} ldfhgvfpylvspvdaegrvradvmgrlcddliqagvhgltplgstgefaylgtaqreav vratieaaqrrvpvvagvastsvadavaqaklyeklgadgilaileayfplkdaqiesyf raiadaveipvviytnpqfqrsdltldviarlaehpriryikdastntgrllsiinrcgd alqvfsasahipaavmliggvgwmagpaciaprqsvalyelckaqrwdealmlqrklwrv neafakfnlaacikaglalqgydvgdpippqaaltaeerkavekvlaeiae
Timeline for d3eb2b_: