Lineage for d3eakb_ (3eak B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742123Domain d3eakb_: 3eak B: [174808]
    automated match to d1ol0a_
    complexed with so4; mutant

Details for d3eakb_

PDB Entry: 3eak (more details), 1.95 Å

PDB Description: NbBCII10 humanized (FGLA mutant)
PDB Compounds: (B:) NbBCII10-FGLA

SCOPe Domain Sequences for d3eakb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eakb_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqpggslrlscaasggseysystfslgwfrqapgqgleavaaiasmggl
tyyadsvkgrftisrdnskntlylqmnslraedtavyycaavrgyfmrlpsshnfrywgq
gtlvtvs

SCOPe Domain Coordinates for d3eakb_:

Click to download the PDB-style file with coordinates for d3eakb_.
(The format of our PDB-style files is described here.)

Timeline for d3eakb_: