SCOPe 2.05: Domain d3eaka_: 3eak A:

Lineage for d3eaka_ (3eak A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (25 PDB entries)

8. Domain d3eaka_: 3eak A: [174807]
   automated match to d1ol0a_
   complexed with so4; mutant

Details for d3eaka_

PDB Entry: 3eak, 1.95 Å

PDB Description: NbBCII10 humanized (FGLA mutant)

PDB Compounds: (A:) NbBCII10-FGLA

SCOPe Domain Sequences for d3eaka_:

Sequence; same for both SEQRES and ATOM records:

>d3eaka_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqpggslrlscaasggseysystfslgwfrqapgqgleavaaiasmggl
tyyadsvkgrftisrdnskntlylqmnslraedtavyycaavrgyfmrlpsshnfrywgq
gtlvtvs

Timeline for d3eaka_:

• d3eaka_ first appeared in SCOPe 2.01
  
• d3eaka_ appears in SCOPe 2.04
  
• d3eaka_ appears in SCOPe 2.06
  
• d3eaka_ appears in the current release, SCOPe 2.08