| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
| Protein automated matches [190966] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188600] (7 PDB entries) |
| Domain d3eaeb_: 3eae B: [174804] automated match to d1n27a_ |
PDB Entry: 3eae (more details), 2.24 Å
SCOPe Domain Sequences for d3eaeb_:
Sequence, based on SEQRES records: (download)
>d3eaeb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkpgdlvfakmkgyphwpariddiadgavkpppnkypifffgthetaflgpkdlfpydkc
kdkygkpnkrkgfneglweiqnnpha
>d3eaeb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkpgdlvfakmkgyphwpariddkypifffgthetaflgpkdlfpydkckdkygkpnkrk
gfneglweiqnnpha
Timeline for d3eaeb_: