Lineage for d3eaea_ (3eae A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2378441Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2378544Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2378564Protein automated matches [190966] (1 species)
    not a true protein
  7. 2378565Species Human (Homo sapiens) [TaxId:9606] [188600] (16 PDB entries)
  8. 2378574Domain d3eaea_: 3eae A: [174803]
    automated match to d1n27a_

Details for d3eaea_

PDB Entry: 3eae (more details), 2.24 Å

PDB Description: pwwp domain of human hepatoma-derived growth factor 2 (hdgf2)
PDB Compounds: (A:) Hepatoma-derived growth factor-related protein 2

SCOPe Domain Sequences for d3eaea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eaea_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phafkpgdlvfakmkgyphwpariddiadgavkpppnkypifffgthetaflgpkdlfpy
dkckdkygkpnkrkgfneglweiqnnphasys

SCOPe Domain Coordinates for d3eaea_:

Click to download the PDB-style file with coordinates for d3eaea_.
(The format of our PDB-style files is described here.)

Timeline for d3eaea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3eaeb_