Lineage for d3ea9a_ (3ea9 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 954798Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 954950Protein automated matches [190384] (8 species)
    not a true protein
  7. 954974Species SARS coronavirus [TaxId:227859] [187411] (12 PDB entries)
  8. 954984Domain d3ea9a_: 3ea9 A: [174796]
    automated match to d1uj1b_
    mutant

Details for d3ea9a_

PDB Entry: 3ea9 (more details), 2.4 Å

PDB Description: crystal structure of sars-cov main protease quadruple mutant stif/a with one molecule in one asymmetric unit
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d3ea9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ea9a_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeatpfdvvrqc
s

SCOPe Domain Coordinates for d3ea9a_:

Click to download the PDB-style file with coordinates for d3ea9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ea9a_: