SCOPe 2.02: Domain d3ea7b_: 3ea7 B:

Lineage for d3ea7b_ (3ea7 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (12 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [187411] (12 PDB entries)

8. Domain d3ea7b_: 3ea7 B: [174794]
   automated match to d1uj1b_
   mutant

Details for d3ea7b_

PDB Entry: 3ea7, 2.65 Å

PDB Description: crystal structure of sars-cov main protease triple mutant sti/a in space group p21

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3ea7b_:

Sequence; same for both SEQRES and ATOM records:

>d3ea7b_ b.47.1.4 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeftpfdvvrqc
s

Timeline for d3ea7b_:

• d3ea7b_ first appeared in SCOPe 2.01
  
• d3ea7b_ appears in SCOPe 2.03
  
• d3ea7b_ appears in the current release, SCOPe 2.08