SCOPe 2.01: Domain d3ea3b_: 3ea3 B:

Lineage for d3ea3b_ (3ea3 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.2: Bacterial PLC [51699] (2 proteins)

6. Protein automated matches [190760] (1 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:1428] [187965] (5 PDB entries)

8. Domain d3ea3b_: 3ea3 B: [174792]
   automated match to d1gyma_
   complexed with mn; mutant

Details for d3ea3b_

PDB Entry: 3ea3, 1.78 Å

PDB Description: crystal structure of the y246s/y247s/y248s/y251s mutant of phosphatidylinositol-specific phospholipase c from bacillus thuringiensis

PDB Compounds: (B:) 1-phosphatidylinositol phosphodiesterase

SCOPe Domain Sequences for d3ea3b_:

Sequence; same for both SEQRES and ATOM records:

>d3ea3b_ c.1.18.2 (B:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspsssassinpeiandikqknptrvgwviqdyinekwspllyqeviranksli

Timeline for d3ea3b_:

• d3ea3b_ is new in SCOPe 2.01-stable
  
• d3ea3b_ appears in SCOPe 2.02
  
• d3ea3b_ appears in the current release, SCOPe 2.08