Lineage for d3ea2b_ (3ea2 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448305Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2448334Family c.1.18.2: Bacterial PLC [51699] (2 proteins)
  6. 2448349Protein automated matches [190760] (2 species)
    not a true protein
  7. 2448354Species Bacillus thuringiensis [TaxId:1428] [187965] (5 PDB entries)
  8. 2448364Domain d3ea2b_: 3ea2 B: [174790]
    automated match to d1gyma_
    complexed with ins, zn; mutant

Details for d3ea2b_

PDB Entry: 3ea2 (more details), 1.95 Å

PDB Description: crystal structure of the myo-inositol bound y247s/y251s mutant of phosphatidylinositol-specific phospholipase c from bacillus thuringiensis
PDB Compounds: (B:) 1-phosphatidylinositol phosphodiesterase

SCOPe Domain Sequences for d3ea2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ea2b_ c.1.18.2 (B:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspysyassinpeiandikqknptrvgwviqdyinekwspllyqeviranksli

SCOPe Domain Coordinates for d3ea2b_:

Click to download the PDB-style file with coordinates for d3ea2b_.
(The format of our PDB-style files is described here.)

Timeline for d3ea2b_: