Lineage for d3ea1a_ (3ea1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839880Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2839909Family c.1.18.2: Bacterial PLC [51699] (2 proteins)
  6. 2839924Protein automated matches [190760] (2 species)
    not a true protein
  7. 2839929Species Bacillus thuringiensis [TaxId:1428] [187965] (5 PDB entries)
  8. 2839930Domain d3ea1a_: 3ea1 A: [174787]
    automated match to d1gyma_
    complexed with zn; mutant

Details for d3ea1a_

PDB Entry: 3ea1 (more details), 1.75 Å

PDB Description: crystal structure of the y247s/y251s mutant of phosphatidylinositol- specific phospholipase c from bacillus thuringiensis
PDB Compounds: (A:) 1-phosphatidylinositol phosphodiesterase

SCOPe Domain Sequences for d3ea1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ea1a_ c.1.18.2 (A:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspysyassinpeiandikqknptrvgwviqdyinekwspllyqeviranksli

SCOPe Domain Coordinates for d3ea1a_:

Click to download the PDB-style file with coordinates for d3ea1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ea1a_: