SCOPe 2.06: Domain d3e9ua1: 3e9u A:555-709

Lineage for d3e9ua1 (3e9u A:555-709)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.0: automated matches [191575] (1 protein)
   not a true family

6. Protein automated matches [191010] (2 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [188762] (3 PDB entries)

8. Domain d3e9ua1: 3e9u A:555-709 [174783]
   Other proteins in same PDB: d3e9ua2
   automated match to d2fwua1

Details for d3e9ua1

PDB Entry: 3e9u, 2.5 Å

PDB Description: Crystal structure of Calx CBD2 domain

PDB Compounds: (A:) Na/Ca exchange protein

SCOPe Domain Sequences for d3e9ua1:

Sequence; same for both SEQRES and ATOM records:

>d3e9ua1 b.1.27.0 (A:555-709) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gifaftdsvfeitesvgrfelkvmrysgargtvivpywtendtateskdyegargelvfe
nnesekfidlfileessyekdvsfkvhigeprlapddglaakikevekkpvqdlteldri
lllskprngelttayvriresqefkatvdklvaka

Timeline for d3e9ua1:

• d3e9ua1 first appeared in SCOPe 2.01, called d3e9ua_
  
• d3e9ua1 was called d3e9ua_ in SCOPe 2.05
  
• d3e9ua1 appears in SCOPe 2.07
  
• d3e9ua1 appears in the current release, SCOPe 2.08