SCOPe 2.05: Domain d3e9ta_: 3e9t A:

Lineage for d3e9ta_ (3e9t A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.0: automated matches [191575] (1 protein)
   not a true family

6. Protein automated matches [191010] (2 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [188762] (3 PDB entries)

8. Domain d3e9ta_: 3e9t A: [174779]
   automated match to d2fwsa1
   complexed with ca

Details for d3e9ta_

PDB Entry: 3e9t, 1.6 Å

PDB Description: Crystal structure of Apo-form Calx CBD1 domain

PDB Compounds: (A:) Na/Ca exchange protein

SCOPe Domain Sequences for d3e9ta_:

Sequence; same for both SEQRES and ATOM records:

>d3e9ta_ b.1.27.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
efirmyfepghytvmencgefevrvvrrgdistyasveyetqdgtasagtdfvgrkglls
fppgvdeqrfrievidddvfeedecfyirlfnpsegvklavpmiatvmildd

Timeline for d3e9ta_:

• d3e9ta_ first appeared in SCOPe 2.01
  
• d3e9ta_ appears in SCOPe 2.04
  
• d3e9ta_ is called d3e9ta1 in SCOPe 2.06
  
• d3e9ta_ appears in the current release, SCOPe 2.08, called d3e9ta1