Lineage for d3e96b_ (3e96 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098432Species Bacillus clausii [TaxId:66692] [188586] (1 PDB entry)
  8. 2098434Domain d3e96b_: 3e96 B: [174770]
    automated match to d1xkya1

Details for d3e96b_

PDB Entry: 3e96 (more details), 1.8 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from bacillus clausii
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3e96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e96b_ c.1.10.0 (B:) automated matches {Bacillus clausii [TaxId: 66692]}
lakaletisgipitpfrksdgsidwhhyketvdrivdngidvivpcgntsefyalsleea
keevrrtveyvhgralvvagigyatstaielgnaakaagadavmihmpihpyvtaggvya
yfrdiiealdfpslvyfkdpeisdrvlvdlaplqnlvgvkyaindlprfakvvrsipeeh
qiawicgtaekwapffwhagakgftsglvnllpqkavemlealrnndndavwriwedivp
fedlrgkynqgnnvvvikeamemlrqnagvtrapvnelsnedkqlvtellsswkllqptk

SCOPe Domain Coordinates for d3e96b_:

Click to download the PDB-style file with coordinates for d3e96b_.
(The format of our PDB-style files is described here.)

Timeline for d3e96b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3e96a_