Lineage for d1mj2d_ (1mj2 D:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.43: Met repressor-like [47597] (1 superfamily) Superfamily a.43.1: Met repressor-like [47598] (2 families) 
Family a.43.1.2: Bacterial repressors [47604] (2 proteins) 
Protein Met repressor, MetR [47607] (1 species) Species Escherichia coli [TaxId:562] [47608] (10 PDB entries) 
Domain d1mj2d_: 1mj2 D: [17477]
Details for d1mj2d_
PDB Entry: 1mj2 (more details), 2.4 Å
PDB Description: methionine repressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to a consensus operator sequence
SCOP Domain Sequences for d1mj2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mj2d_ a.43.1.2 (D:) Met repressor, MetR {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey
SCOP Domain Coordinates for d1mj2d_:
Click to download the PDB-style file with coordinates for d1mj2d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mj2d_:
- d1mj2d_ appears in SCOP 1.57
- d1mj2d_ appears in the current release, SCOPe 2.08
View in 3D
