Lineage for d3e95b_ (3e95 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164342Protein automated matches [190124] (12 species)
    not a true protein
  7. 2164442Species Plasmodium falciparum [TaxId:36329] [187963] (5 PDB entries)
  8. 2164453Domain d3e95b_: 3e95 B: [174768]
    Other proteins in same PDB: d3e95c_
    automated match to d1j7db_
    complexed with unx

Details for d3e95b_

PDB Entry: 3e95 (more details), 2.5 Å

PDB Description: crystal structure of the plasmodium falciparum ubiquitin conjugating enzyme complex, pfubc13-pfuev1a
PDB Compounds: (B:) Ubiquitin carrier protein

SCOPe Domain Sequences for d3e95b_:

Sequence, based on SEQRES records: (download)

>d3e95b_ d.20.1.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
iprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqyp
meppkvrfltkiyhpnidklgricldilkdkwspalqirtvllsiqallsspepddplds
kvaehfkqdkndaehvarqwnkiyannn

Sequence, based on observed residues (ATOM records): (download)

>d3e95b_ d.20.1.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
iprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqyp
meppkvrfltkiyhpnidklgricldilkdkwspalqirtvllsiqallsspepdddskv
aehfkqdkndaehvarqwnkiyannn

SCOPe Domain Coordinates for d3e95b_:

Click to download the PDB-style file with coordinates for d3e95b_.
(The format of our PDB-style files is described here.)

Timeline for d3e95b_: