Lineage for d3e91b_ (3e91 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2407160Protein automated matches [190384] (21 species)
    not a true protein
  7. 2407363Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries)
  8. 2407382Domain d3e91b_: 3e91 B: [174765]
    automated match to d1uj1b_
    mutant

Details for d3e91b_

PDB Entry: 3e91 (more details), 2.55 Å

PDB Description: crystal structure of sars-cov mpro mutant in p21 at ph6.9
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3e91b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e91b_ b.47.1.4 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeftpfdvvrqc

SCOPe Domain Coordinates for d3e91b_:

Click to download the PDB-style file with coordinates for d3e91b_.
(The format of our PDB-style files is described here.)

Timeline for d3e91b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3e91a_