SCOPe 2.05: Domain d3e90d_: 3e90 D:

Lineage for d3e90d_ (3e90 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (4 species)
   not a true protein

7. Species West Nile virus [TaxId:11082] [187751] (2 PDB entries)

8. Domain d3e90d_: 3e90 D: [174763]
   automated match to d2ijob1
   protein/RNA complex; complexed with nkk

Details for d3e90d_

PDB Entry: 3e90, 2.45 Å

PDB Description: West Nile vi rus NS2B-NS3protease in complexed with inhibitor Naph-KKR-H

PDB Compounds: (D:) NS3 protease

SCOPe Domain Sequences for d3e90d_:

Sequence, based on SEQRES records:

>d3e90d_ b.47.1.3 (D:) automated matches {West Nile virus [TaxId: 11082]}
ggvlwdtpspkeykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalms
gegrldpywgsvkedrlcyggpwklqhkwngqdevqmivvepgknvknvrtkpgvfktpe
geigavtldfptgtsgspivdkngdviglygngvimpngsyisaivqgkrmdep

Sequence, based on observed residues (ATOM records):

>d3e90d_ b.47.1.3 (D:) automated matches {West Nile virus [TaxId: 11082]}
ggvlwykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldp
ywgsvkedrlcyggpwklqhkwngqdevqmivvepgknvknvrtkpgvfktpegeigavt
ldfptgtsgspivdkngdviglygngvimpngsyisaivqgkrmdep

Timeline for d3e90d_:

• d3e90d_ first appeared in SCOPe 2.01
  
• d3e90d_ appears in SCOPe 2.04
  
• d3e90d_ appears in SCOPe 2.06
  
• d3e90d_ appears in the current release, SCOPe 2.08, called d3e90d1