Lineage for d3e90d1 (3e90 D:3-174)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797067Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2797157Protein automated matches [190658] (12 species)
    not a true protein
  7. 2797267Species West Nile virus [TaxId:11082] [187751] (2 PDB entries)
  8. 2797270Domain d3e90d1: 3e90 D:3-174 [174763]
    Other proteins in same PDB: d3e90a_, d3e90b2, d3e90c_, d3e90d2
    automated match to d2ijob1
    protein/RNA complex; complexed with nkk

Details for d3e90d1

PDB Entry: 3e90 (more details), 2.45 Å

PDB Description: West Nile vi rus NS2B-NS3protease in complexed with inhibitor Naph-KKR-H
PDB Compounds: (D:) NS3 protease

SCOPe Domain Sequences for d3e90d1:

Sequence, based on SEQRES records: (download)

>d3e90d1 b.47.1.3 (D:3-174) automated matches {West Nile virus [TaxId: 11082]}
vlwdtpspkeykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsge
grldpywgsvkedrlcyggpwklqhkwngqdevqmivvepgknvknvrtkpgvfktpege
igavtldfptgtsgspivdkngdviglygngvimpngsyisaivqgkrmdep

Sequence, based on observed residues (ATOM records): (download)

>d3e90d1 b.47.1.3 (D:3-174) automated matches {West Nile virus [TaxId: 11082]}
vlwykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpyw
gsvkedrlcyggpwklqhkwngqdevqmivvepgknvknvrtkpgvfktpegeigavtld
fptgtsgspivdkngdviglygngvimpngsyisaivqgkrmdep

SCOPe Domain Coordinates for d3e90d1:

Click to download the PDB-style file with coordinates for d3e90d1.
(The format of our PDB-style files is described here.)

Timeline for d3e90d1: