Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein automated matches [190658] (12 species) not a true protein |
Species West Nile virus [TaxId:11082] [187751] (2 PDB entries) |
Domain d3e90d1: 3e90 D:3-174 [174763] Other proteins in same PDB: d3e90a_, d3e90b2, d3e90c_, d3e90d2 automated match to d2ijob1 protein/RNA complex; complexed with nkk |
PDB Entry: 3e90 (more details), 2.45 Å
SCOPe Domain Sequences for d3e90d1:
Sequence, based on SEQRES records: (download)
>d3e90d1 b.47.1.3 (D:3-174) automated matches {West Nile virus [TaxId: 11082]} vlwdtpspkeykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsge grldpywgsvkedrlcyggpwklqhkwngqdevqmivvepgknvknvrtkpgvfktpege igavtldfptgtsgspivdkngdviglygngvimpngsyisaivqgkrmdep
>d3e90d1 b.47.1.3 (D:3-174) automated matches {West Nile virus [TaxId: 11082]} vlwykkgdtttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpyw gsvkedrlcyggpwklqhkwngqdevqmivvepgknvknvrtkpgvfktpegeigavtld fptgtsgspivdkngdviglygngvimpngsyisaivqgkrmdep
Timeline for d3e90d1:
View in 3D Domains from other chains: (mouse over for more information) d3e90a_, d3e90b1, d3e90b2, d3e90c_ |