Lineage for d1mj2c_ (1mj2 C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47945Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 47946Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 47986Family a.43.1.2: Bacterial repressors [47604] (2 proteins)
  6. 47987Protein Met repressor, MetR [47607] (1 species)
  7. 47988Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. 48005Domain d1mj2c_: 1mj2 C: [17476]

Details for d1mj2c_

PDB Entry: 1mj2 (more details), 2.4 Å

PDB Description: methionine repressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to a consensus operator sequence

SCOP Domain Sequences for d1mj2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mj2c_ a.43.1.2 (C:) Met repressor, MetR {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOP Domain Coordinates for d1mj2c_:

Click to download the PDB-style file with coordinates for d1mj2c_.
(The format of our PDB-style files is described here.)

Timeline for d1mj2c_: