Lineage for d3e8jb_ (3e8j B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008710Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 3008711Superfamily d.248.1: Coproporphyrinogen III oxidase [102886] (2 families) (S)
    automatically mapped to Pfam PF01218
  5. 3008712Family d.248.1.1: Coproporphyrinogen III oxidase [102887] (3 proteins)
    Pfam PF01218
  6. 3008730Protein automated matches [190407] (4 species)
    not a true protein
  7. 3008744Species Leishmania naiffi [TaxId:5678] [188584] (1 PDB entry)
  8. 3008746Domain d3e8jb_: 3e8j B: [174750]
    automated match to d1vjua_
    complexed with act, gol

Details for d3e8jb_

PDB Entry: 3e8j (more details), 2.27 Å

PDB Description: coproporphyrinogen iii oxidase from leishmania naiffi
PDB Compounds: (B:) Coproporphyrinogen III oxidase

SCOPe Domain Sequences for d3e8jb_:

Sequence, based on SEQRES records: (download)

>d3e8jb_ d.248.1.1 (B:) automated matches {Leishmania naiffi [TaxId: 5678]}
mslpveavkefllklqddichaieaedeqatfmedkwtregggggrtrviangaviekgg
vnfshvygkglpgssterhpdmagcnyqamgvslvihpknphvptshanvrlfvaekegk
epvwwfgggfdltpyyaveedcyyfhhvaqelcrpfgadvyerfkawcdeyffiphrnea
rgigglffddlnewpfekcfafmqavgkgfidayipivnrrkntpyteqqvefqefrrgr
yaefnlvidrgtkfglqsggrtesilmslpprarwgynwhpepgtpearlteyfltkkqw
v

Sequence, based on observed residues (ATOM records): (download)

>d3e8jb_ d.248.1.1 (B:) automated matches {Leishmania naiffi [TaxId: 5678]}
mslpveavkefllklqddichaieaedeqatfmedkwtregggggrtrviangaviekgg
vnfshvygkggcnyqamgvslvihpknphvptshanvrlfvaegkepvwwfgggfdltpy
yaveedcyyfhhvaqelcrpfgadvyerfkawcdeyffiphrneargigglffddlnewp
fekcfafmqavgkgfidayipivnrrkntpyteqqvefqefrrgryaefnlvidrgtkfg
lqsggrtesilmslpprarwgynwhpepgtpearlteyfltkkqwv

SCOPe Domain Coordinates for d3e8jb_:

Click to download the PDB-style file with coordinates for d3e8jb_.
(The format of our PDB-style files is described here.)

Timeline for d3e8jb_: