SCOPe 2.08: Domain d3e8ep_: 3e8e P:

Lineage for d3e8ep_ (3e8e P:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries)

8. Domain d3e8ep_: 3e8e P: [174748]
   automated match to d1cmke_
   complexed with g98

Details for d3e8ep_

PDB Entry: 3e8e, 2 Å

PDB Description: crystal structures of the kinase domain of pka in complex with atp- competitive inhibitors

PDB Compounds: (P:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3e8ep_:

Sequence; same for both SEQRES and ATOM records:

>d3e8ep_ d.144.1.7 (P:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d3e8ep_:

• d3e8ep_ first appeared in SCOPe 2.01
  
• d3e8ep_ appears in SCOPe 2.07