Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (10 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187007] (27 PDB entries) |
Domain d3e8ee_: 3e8e E: [174745] automated match to d1cmke_ complexed with g98 |
PDB Entry: 3e8e (more details), 2 Å
SCOPe Domain Sequences for d3e8ee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e8ee_ d.144.1.7 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d3e8ee_: