Lineage for d3e8cc_ (3e8c C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1931611Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries)
  8. 1931636Domain d3e8cc_: 3e8c C: [174739]
    automated match to d1cmke_
    complexed with g96

Details for d3e8cc_

PDB Entry: 3e8c (more details), 2.2 Å

PDB Description: crystal structures of the kinase domain of pka in complex with atp- competitive inhibitors
PDB Compounds: (C:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3e8cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e8cc_ d.144.1.7 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d3e8cc_:

Click to download the PDB-style file with coordinates for d3e8cc_.
(The format of our PDB-style files is described here.)

Timeline for d3e8cc_: