Lineage for d3e7nn1 (3e7n N:1-138)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2170207Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 2170208Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 2170235Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 2170236Protein automated matches [190962] (6 species)
    not a true protein
  7. 2170262Species Salmonella typhimurium [TaxId:90371] [188582] (2 PDB entries)
  8. 2170276Domain d3e7nn1: 3e7n N:1-138 [174732]
    Other proteins in same PDB: d3e7na2, d3e7nb2, d3e7nc2, d3e7nd2, d3e7ne2, d3e7nf2, d3e7ng2, d3e7nh2, d3e7ni2, d3e7nj2, d3e7nk2, d3e7nl2, d3e7nm2, d3e7nn2, d3e7no2
    automated match to d1ogca_
    complexed with edo

Details for d3e7nn1

PDB Entry: 3e7n (more details), 2.45 Å

PDB Description: Crystal structure of d-ribose high-affinity transport system from salmonella typhimurium lt2
PDB Compounds: (N:) D-ribose high-affinity transport system

SCOPe Domain Sequences for d3e7nn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e7nn1 c.133.1.0 (N:1-138) automated matches {Salmonella typhimurium [TaxId: 90371]}
mkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvvtr
emqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqavi
rsgecspyanvilcagvt

SCOPe Domain Coordinates for d3e7nn1:

Click to download the PDB-style file with coordinates for d3e7nn1.
(The format of our PDB-style files is described here.)

Timeline for d3e7nn1: