Lineage for d3e7nm_ (3e7n M:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1886150Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 1886151Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 1886178Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 1886179Protein automated matches [190962] (6 species)
    not a true protein
  7. 1886205Species Salmonella typhimurium [TaxId:90371] [188582] (1 PDB entry)
  8. 1886218Domain d3e7nm_: 3e7n M: [174731]
    automated match to d1ogca_
    complexed with edo

Details for d3e7nm_

PDB Entry: 3e7n (more details), 2.45 Å

PDB Description: Crystal structure of d-ribose high-affinity transport system from salmonella typhimurium lt2
PDB Compounds: (M:) D-ribose high-affinity transport system

SCOPe Domain Sequences for d3e7nm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e7nm_ c.133.1.0 (M:) automated matches {Salmonella typhimurium [TaxId: 90371]}
namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
virsgecspyanvilcagvt

SCOPe Domain Coordinates for d3e7nm_:

Click to download the PDB-style file with coordinates for d3e7nm_.
(The format of our PDB-style files is described here.)

Timeline for d3e7nm_: