SCOPe 2.08: Domain d3e7ne1: 3e7n E:1-138

Lineage for d3e7ne1 (3e7n E:1-138)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.133: RbsD-like [102545] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest

4. Superfamily c.133.1: RbsD-like [102546] (2 families)

5. Family c.133.1.0: automated matches [191558] (1 protein)
   not a true family

6. Protein automated matches [190962] (7 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [188582] (2 PDB entries)

8. Domain d3e7ne1: 3e7n E:1-138 [174723]
   Other proteins in same PDB: d3e7na2, d3e7nb2, d3e7nc2, d3e7nd2, d3e7ne2, d3e7nf2, d3e7ng2, d3e7nh2, d3e7ni2, d3e7nj2, d3e7nk2, d3e7nl2, d3e7nm2, d3e7nn2, d3e7no2
   automated match to d1ogca_
   complexed with edo

Details for d3e7ne1

PDB Entry: 3e7n, 2.45 Å

PDB Description: Crystal structure of d-ribose high-affinity transport system from salmonella typhimurium lt2

PDB Compounds: (E:) D-ribose high-affinity transport system

SCOPe Domain Sequences for d3e7ne1:

Sequence; same for both SEQRES and ATOM records:

>d3e7ne1 c.133.1.0 (E:1-138) automated matches {Salmonella typhimurium [TaxId: 90371]}
mkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvvtr
emqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqavi
rsgecspyanvilcagvt

Timeline for d3e7ne1:

• d3e7ne1 first appeared in SCOPe 2.01, called d3e7ne_
  
• d3e7ne1 appears in SCOPe 2.07