Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
Superfamily c.133.1: RbsD-like [102546] (2 families) |
Family c.133.1.0: automated matches [191558] (1 protein) not a true family |
Protein automated matches [190962] (6 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [188582] (2 PDB entries) |
Domain d3e7nc1: 3e7n C:1-139 [174721] Other proteins in same PDB: d3e7na2, d3e7nb2, d3e7nc2, d3e7nd2, d3e7ne2, d3e7nf2, d3e7ng2, d3e7nh2, d3e7ni2, d3e7nj2, d3e7nk2, d3e7nl2, d3e7nm2, d3e7nn2, d3e7no2 automated match to d1ogca_ complexed with edo |
PDB Entry: 3e7n (more details), 2.45 Å
SCOPe Domain Sequences for d3e7nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e7nc1 c.133.1.0 (C:1-139) automated matches {Salmonella typhimurium [TaxId: 90371]} mkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvvtr emqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqavi rsgecspyanvilcagvtf
Timeline for d3e7nc1:
View in 3D Domains from other chains: (mouse over for more information) d3e7na1, d3e7na2, d3e7nb1, d3e7nb2, d3e7nd1, d3e7nd2, d3e7ne1, d3e7ne2, d3e7nf1, d3e7nf2, d3e7ng1, d3e7ng2, d3e7nh1, d3e7nh2, d3e7ni1, d3e7ni2, d3e7nj1, d3e7nj2, d3e7nk1, d3e7nk2, d3e7nl1, d3e7nl2, d3e7nm1, d3e7nm2, d3e7nn1, d3e7nn2, d3e7no1, d3e7no2 |