Lineage for d3e7nc_ (3e7n C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1012703Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 1012704Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 1012731Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 1012732Protein automated matches [190962] (6 species)
    not a true protein
  7. 1012758Species Salmonella typhimurium [TaxId:90371] [188582] (1 PDB entry)
  8. 1012761Domain d3e7nc_: 3e7n C: [174721]
    automated match to d1ogca_
    complexed with edo

Details for d3e7nc_

PDB Entry: 3e7n (more details), 2.45 Å

PDB Description: Crystal structure of d-ribose high-affinity transport system from salmonella typhimurium lt2
PDB Compounds: (C:) D-ribose high-affinity transport system

SCOPe Domain Sequences for d3e7nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e7nc_ c.133.1.0 (C:) automated matches {Salmonella typhimurium [TaxId: 90371]}
namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
virsgecspyanvilcagvtf

SCOPe Domain Coordinates for d3e7nc_:

Click to download the PDB-style file with coordinates for d3e7nc_.
(The format of our PDB-style files is described here.)

Timeline for d3e7nc_: