Lineage for d3e7db_ (3e7d B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2859540Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) (S)
    fold elaborated with additional structures
    automatically mapped to Pfam PF02570
  5. 2859541Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins)
  6. 2859555Protein automated matches [190963] (2 species)
    not a true protein
  7. 2859556Species Brucella abortus [TaxId:235] [188583] (1 PDB entry)
  8. 2859558Domain d3e7db_: 3e7d B: [174716]
    automated match to d1f2va_

Details for d3e7db_

PDB Entry: 3e7d (more details), 1.8 Å

PDB Description: crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis
PDB Compounds: (B:) CobH, precorrin-8X methylmutase

SCOPe Domain Sequences for d3e7db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e7db_ c.23.17.1 (B:) automated matches {Brucella abortus [TaxId: 235]}
yirdgqaiydrsfaiiraeadlrhipadleklavrvihacgmvdvandlafsegagkagr
nallagapilcdarmvaegitrsrlpadnrviytlsdpsvpelakkigntrsaaaldlwl
phiegsivaignaptalfrlfelldagapkpaliigmpvgfvgaaeskdelaansrgvpy
vivrgrrggsamtaaavnalaser

SCOPe Domain Coordinates for d3e7db_:

Click to download the PDB-style file with coordinates for d3e7db_.
(The format of our PDB-style files is described here.)

Timeline for d3e7db_: